PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_52321.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family SBP
Protein Properties Length: 360aa    MW: 38687.8 Da    PI: 8.9463
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_52321.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.91.1e-4128104278
                   -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
           SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                   C vegC+adls+++eyhrrhkvCe+hsk+pvv+v+g++qrfCqqCsrfh l efDe krsCr+rL++hn+rrrk+q+
  MLOC_52321.2  28 CSVEGCTADLSRCREYHRRHKVCEAHSKTPVVAVAGQQQRFCQQCSRFHLLGEFDEVKRSCRKRLDGHNRRRRKPQP 104
                   **************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.2E-341989IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.13725102IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.49E-3926106IPR004333Transcription factor, SBP-box
PfamPF031103.5E-3028101IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
QQQQQQPPSA ATAKRARAGQ GQQTVPACSV EGCTADLSRC REYHRRHKVC EAHSKTPVVA  60
VAGQQQRFCQ QCSRFHLLGE FDEVKRSCRK RLDGHNRRRR KPQPDPLNPA GLFANHHGVP  120
RFASYPQIFS PTSMAEPKWP GGIAVKTEAD AFHEQYYSFN GAASLFHHGK PERKHFPFLT  180
DGGDATFGCQ PPAFTITPSS ESSSNSSRHS NGKTTMFAHD GGPDHNCALS LLSDNPAPAH  240
IMNPAEAHHL GGGGGVTIQY GGGGGGKVAR LHNNGDVSLT GLSYVSLGDK GAPMLLHTSN  300
RSQHAAATAT TAVTTSTAPA PTASQMQQYH GYYHHQHQVG ADQGNHQDAG GMHALPFSSW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-2821101484squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
184101KRSCRKRLDGHNRRRRKP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00555DAPTransfer from AT5G50570Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3560770.0AK356077.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1029L02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010232756.11e-124PREDICTED: squamosa promoter-binding-like protein 2
SwissprotQ0JGI11e-109SPL2_ORYSJ; Squamosa promoter-binding-like protein 2
TrEMBLM0WKB10.0M0WKB1_HORVD; Uncharacterized protein
STRINGMLOC_52321.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP104563038
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.11e-35SBP family protein